DPCstruct | MC56561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 103 ± 7 aa |
| Standard deviation of domain lengths | 6.78 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 74.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A7B8W4 | 57-158 | VAAGSLPDAMMEYIKADLNATFGVANHIRRSRQTGLPQIKKVIYSGPKTIILWADNTKTIVSCGEADSYDYYSGFCAAVVKKLFGST… |
| A0A662LJ12 | 30-122 | QYNLCEGYHCDDAYENYKDDFENEMETKMKHNKVIFSGNATIVFWEDNTKTIVKCSDNDSFDSEKGFLIAYYQKHTGNSKKQTSKVL… |
| A0A329UPJ3 | 62-161 | None |
| A0A374RUE2 | 67-182 | None |
| H1CC35 | 9-118 | None |
| A0A6M5GFZ1 | 36-132 | None |
| A0A351RFS2 | 93-197 | None |
| A0A372X2P5 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.