DPCstruct | MC56558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Standard deviation of domain lengths | 9.14 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00395 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S7RDY3 | 1-78 | MVVDGIAGPTTLSKIEELIKLSNKGPFPDVPKNHWASEAIETVKEAGIMNGFADGTFKPNEPVTRAQLATVVANIFKN |
| A0A7C5XVL9 | 100-158 | SAPATATFPDVPTDHWAFQYIEALAASGITQGFPDGTFRPTSPVTRAQMATFLSRALGL |
| A0A7C3HUX6 | 6-93 | None |
| A0A4R1QCA2 | 3-81 | None |
| A0A7Y6BXG6 | 3-77 | None |
| K2DJY3 | 5-80 | None |
| U5CYM8 | 28-111 | None |
| A0A7C6YRR2 | 9-87 | None |
| F2BWQ5 | 784-875 | None |
| A0A220MC21 | 2-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.