DPCstruct | MC56557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 145 |
|---|---|
| Mean domain length (aa) | 97 ± 13 aa |
| Standard deviation of domain lengths | 12.83 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0640 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S7LCF3 | 6-94 | SFRTLSLLDSHYKKHVIVQKEFGNITKNQYLTRAQNLIGSDSKNVLSKKRSNGDRVFYNTSNNEFAVLGKDGYIKTFFKPKDGFRYY… |
| A0A2T0TGJ8 | 696-778 | GQEIAGGHAYPKHVVERGEFRGVHSRDDFAKVVENTIVQGESRPLSNGRTAYWHDGVVVIRNPRAPDGGSAFAPTQGRQYFLN |
| A0A116NAA0 | 187-310 | None |
| A0A1H7M5G9 | 86-179 | None |
| A0A7J0BPG4 | 294-394 | None |
| A0A1I5AU65 | 21-125 | None |
| A0A3A9ZJN3 | 4-90 | None |
| A0A397JKA2 | 86-182 | None |
| A0A447QP09 | 28-128 | None |
| A0A848D6T9 | 173-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.