DPCstruct | MC5655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 166 ± 21 aa |
| Standard deviation of domain lengths | 21.45 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.80 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12720 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7A4X9 | 1-131 | MASTFEIPTITPQDLSNFHKAHLSLDLHQHFTRTFLQPQPQVSENPLEHEPEHPSEEEEDDLGYYPDGTKRTLTSAQVDMFRFSEIQ… |
| A0A7T6XUI8 | 1-147 | MQVPTVTLDDLQAFQSKHFPGQQPAVFPQENDQTTDEDLGYYPDGIKRTLTDEQIRIFRHSEIHALLRERQLKAEEAQYQSRMQSST… |
| A0A1B8B1Y2 | 1-174 | None |
| A0A2K1QSV7 | 1-225 | None |
| A0A094GI82 | 56-230 | None |
| A0A4Q4RXD0 | 1-175 | None |
| A0A3D8S6Q3 | 2-175 | None |
| A1DBC0 | 2-171 | None |
| A0A6A6PQT0 | 30-207 | None |
| A0A1Y2D9Z2 | 7-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.