DPCstruct | MC5654
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 310 ± 32 aa |
| Standard deviation of domain lengths | 32.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 65.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.70 |
| Pfam Score | 84.13 |
| Assigned Pfam label(s) | PF02755- CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817FH08 | 21-262 | QQINEQSLRQDLEKNRESLQRKLQTRRSLQQLVDVGIMPTPKVSLPFYQQRKQLQMRKTKDILKNKILFRPDRQLLIEHNILSDTTA… |
| A0A4W4FF33 | 38-310 | LAVLQIKLQQRRTREELVSQGIMPPLKSPAAFHEQRRSLERARTEDYLKRKIRARPDRSELVRMHILEETSAEPSLQAKQLLLKRAR… |
| A0A0B1TRG0 | 1-322 | None |
| A0A2K6NE59 | 2-343 | None |
| A0A6P8Q6R2 | 14-334 | None |
| A0A814CFA7 | 15-329 | None |
| A0A4W6BL73 | 4-287 | None |
| A0A437D4X2 | 31-348 | None |
| A0A3M0IUP3 | 3-377 | None |
| A0A2W1BF28 | 28-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.