DPCstruct | MC56534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 80 ± 10 aa |
| Standard deviation of domain lengths | 9.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.32 |
| Pfam Score | 88.10 |
| Assigned Pfam label(s) | PF14365- PF03080 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A0L581 | 1-76 | MDKVVSHSLEKGTEKYYGTKSYMSVYNVSLSFDQSSSTNIWIVGGPVDSLGVLMTGWLVNPEVNGDFVTRSFVYWT |
| A0A565CU89 | 1-77 | MLNGSGSSRGRGQYYIGAISHINVWNPSGVQAADYTSAQIWLLGELSDVFESKEAGWMVNPKVFGDNCTRLFTYWTV |
| A0A453EV59 | 95-172 | None |
| A0A6P5U5R2 | 128-195 | None |
| A0A3P6D4A9 | 79-169 | None |
| A0A218XLY8 | 32-106 | None |
| A0A5J9V6S1 | 81-152 | None |
| A0A7J6H0M1 | 68-140 | None |
| A0A5P1FPD7 | 1-102 | None |
| A0A287ELR4 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.