DPCstruct | MC56533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 204 ± 37 aa |
| Standard deviation of domain lengths | 37.33 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.89 |
| Pfam Score | 80.95 |
| Assigned Pfam label(s) | CL0023- CL0671 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K5UPB1 | 11-249 | SSLAVIFPNSVVREDIFAECKDVFFGVGATTAAVRQHLELISSMIAEYLGLSPERKDWVLRGRVPDFNIDKDVNGSVTCVQIGNTRL… |
| A0A565CQW5 | 2-189 | STQNRVTVCEIVASIWNVAVPESQHKPLIQEFSGILKIGRVSLPLGVTASHDRSRFIETRTSTRLLEKIARSVEYNEPVLLVGETGT… |
| A0A368F550 | 39-264 | None |
| A0A7J6PGT8 | 12-264 | None |
| A0A7J8KCD1 | 565-770 | None |
| A0A1Y3ETQ2 | 354-550 | None |
| S9UNV5 | 250-466 | None |
| A0A3P7LEM6 | 285-540 | None |
| A0A820HZX8 | 1-138 | None |
| A0A180G5S6 | 17-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.