DPCstruct | MC56532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 137 ± 31 aa |
| Standard deviation of domain lengths | 30.95 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 76.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 44.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A565CQQ1 | 3-133 | DLWKVAFPVGTEWNQLDAIYEFNWDFKNLEEALEEGGMLYGKKVFVFGSAEPQLVLYEGVNRIVHVPTVIAIESPFPPSDKVAITSI… |
| A0A453D558 | 1-100 | WENIDKIKEFNWNFENLEKALEEGGKLYGKTVYVFGSTEPQLLNVDGESKIVLIPVVVAVDCPFPPSDKIGINSVQRENEEIVPMRA… |
| A0A2P6N2Q2 | 97-296 | None |
| A0A7S2MWD0 | 8-145 | None |
| A0A5N6PQT2 | 23-201 | None |
| A0A835IQM8 | 34-175 | None |
| A0A3P6D736 | 240-335 | None |
| A0A4S4E5B8 | 178-293 | None |
| E1F5Q2 | 4-177 | None |
| A0A2U1N7U7 | 1-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.