DPCstruct | MC56527
Metacluster Properties and Pfam Annotations
| Number of structural domains | 437 |
|---|---|
| Mean domain length (aa) | 153 ± 35 aa |
| Standard deviation of domain lengths | 35.44 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 73.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.21 |
| Pfam Score | 98.18 |
| Assigned Pfam label(s) | CL0010- CL0229- PF05964 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482SM59 | 11-151 | GEIVFGKFATFPYWPCCIVDPTRLNEKKDVINKGLKVAGKQYTVLFYGETSVGYINLDRIKPYNEETKADMLKQNLKKTEADFLKAI… |
| A0A2Z5U8D0 | 6-118 | LVWAKCRGYPWYPALIIDPKMPKGFIYNGVPLPVPPQDVLNLKKNYSHEPILYLVLFFDVKRTWQWLPPNKLELLGIDKAVDQAKMV… |
| A0A397F0L4 | 1033-1184 | None |
| A0A061RG98 | 104-271 | None |
| A0A287X4A3 | 35-146 | None |
| A0A4Y7JCZ5 | 4-179 | None |
| T1E941 | 2-155 | None |
| A0A834XMX8 | 251-340 | None |
| A0A5S6Q582 | 199-308 | None |
| B4DZ41 | 633-746 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.