DPCstruct | MC5652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 228 ± 33 aa |
| Standard deviation of domain lengths | 33.49 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W4FA67 | 17-258 | RDYLKIDIIFDNEDLDCRRAEDWLALGYEQGSNERRPIPAKALLPACDTISPGTELPYSWQPVGVLDYSQKRKQYMVQRSDPSGRVR… |
| A0A812QGE6 | 177-368 | LQLDDFNNTEFDIRMPDQWLELGQQPDGSFLPLQAKALRIYETKGSVWEDCTVEGLKDLEDGKGTKEFLVRWASSPEKDLEPVGRLR… |
| G0R3E6 | 33-220 | None |
| A0A7J6SB87 | 121-343 | None |
| A0A7J6PZL6 | 258-462 | None |
| A0A813B5L6 | 34-269 | None |
| A0A0V0QSY4 | 429-687 | None |
| A0A7G2CQX3 | 184-409 | None |
| W2PCQ8 | 135-373 | None |
| A0A7J6QNS3 | 9-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.