DPCstruct | MC56518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 170 ± 17 aa |
| Standard deviation of domain lengths | 17.12 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 16.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482SAQ7 | 1-173 | MEGQSQRRKSFVQAPTVEVIFEGSKTYWKARTTLEILIAFHLKQACYEVIVFHPDVGKEAPRIYLSAPILASKIDQKELQQRIADKK… |
| A0A7S3GZZ0 | 1-171 | MASRKQSFVAGDGFDVLFDGSKSFWKTRSNLDILIASHKKQLCIEVVSYNAEIGVEAPRIYLSSMLLSTKINPQSEEFVSKLGAKKE… |
| B8C1D6 | 209-357 | None |
| A0A482SHY3 | 1-194 | None |
| K3WGW9 | 34-197 | None |
| A0A1V9Z3L1 | 60-203 | None |
| A0A482SQA5 | 58-237 | None |
| A0A7S2BJX7 | 140-334 | None |
| A0A7S3H586 | 193-365 | None |
| A0A7S3MA92 | 2-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.