DPCstruct | MC56513
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 244 ± 31 aa |
| Standard deviation of domain lengths | 31.04 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14664 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482S3M2 | 9-216 | DFDVTVNEILNVLQQRSDGRLTSQPSSSLVSIYGLINSLEKCTVTLTVYQGFLSSVRSTFVAAESTKRGLILRAIRLCLQNAAFIKV… |
| G3ULV8 | 9-218 | DNLREILQNVAKLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFNYEDIIICLRLALLNEAKEVRAAGLRALRYLIQDSIILQKVLK… |
| A0A4Y9ZL48 | 81-326 | None |
| A0A381LJS5 | 212-432 | None |
| A0A0B2USL3 | 11-310 | None |
| A0A2P8YP61 | 28-286 | None |
| A0A368G188 | 36-318 | None |
| A0A2H2I4N8 | 47-299 | None |
| A0A0D2GW13 | 214-470 | None |
| U7Q2K3 | 226-430 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.