DPCstruct | MC5651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 315 ± 20 aa |
| Standard deviation of domain lengths | 19.66 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 64.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151NRG3 | 12-293 | PVEDCVQNTLSALYPPFTATAPTLLGQVFDVVEKTYREDALRYTLEFLVPAKHILARIQQEACSQYSGFVFCHEGWPLCLHEKIVVQ… |
| A0A4W4F9Z1 | 11-312 | SLDSCIQSTLSVLYAPFGATAATVLWQLFSVVERQYRGDGLRCFLDFLLPAKRILHTIQRETCLRYQGLLLYHDGWPLCIHEKVVLQ… |
| A0A3B3I8W5 | 48-328 | None |
| A0A2K5LRK6 | 6-311 | None |
| A0A6P4Z5S6 | 57-373 | None |
| A2AC60 | 4-311 | None |
| A0A7J6CYX6 | 1-322 | None |
| H3AE49 | 9-321 | None |
| A0A673I6I9 | 5-348 | None |
| A0A3B3QDQ3 | 9-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.