DPCstruct | MC56505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 135 ± 25 aa |
| Standard deviation of domain lengths | 24.84 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13891 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J3M5T7 | 1-97 | MAMARFCHSHILSDPKQVLYKGCAYITKSGAQLGQITCGRPILKASVPSLCNIHFQKSQKLIAHAYKKVGFNRSPNFGLLVAESIRQ… |
| A0A7C8YN20 | 1-156 | GNGNSGQINGHHHHNGSRDCDGKLGLGFGGSFNECLVDRCQSKAMPLTRYCHPHILLDPKQTLYKRCKFVIRRSSADIICSTDAGTI… |
| A0A388L031 | 159-338 | None |
| A0A6A5LG05 | 76-215 | None |
| F1A0W3 | 380-517 | None |
| A0A7J7N315 | 37-190 | None |
| A0A4S8JD18 | 263-384 | None |
| A0A835S496 | 1-106 | None |
| T1NBW4 | 5-123 | None |
| A0A6S7NKJ4 | 89-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.