DPCstruct | MC5650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 173 ± 18 aa |
| Standard deviation of domain lengths | 17.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 52.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17098 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I3SBH0 | 1-127 | MTREEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQV… |
| A0A4W4F744 | 1-163 | MTNEEPLPKKVRLSESDMKTLTREELCSRWKQHEAYVQVLEAKYADLNSNDVTGLKESEEKLKQQQQESARRENILVMRLATKEQEM… |
| A0A7R8CQ79 | 17-174 | None |
| T1K0K2 | 27-205 | None |
| A0A4W2EGA6 | 1-176 | None |
| T2MD12 | 15-185 | None |
| A0A7M4FL24 | 1-184 | None |
| A0A2G8LE24 | 1-170 | None |
| E9G607 | 2-180 | None |
| A0A7R8WIB1 | 17-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.