DPCstruct | MC565
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 159 ± 24 aa |
| Standard deviation of domain lengths | 24.10 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4GAX8 | 31-182 | VVSKARAEGLNGAVGAFDDGTVRQIAKQLASAPYKAPDQSLPKAIDNLNFDQFRSIAYREEKALWHGENLAFDAEFFPRGFLYRPRI… |
| A0A6N6X9D2 | 1-135 | IDDVAKQAQSLAGKGYEAPKSNLPSVFRDMKYADYQQIQFNRDKAYWSNLKTLFKLEFYHQGMYFDTPVKINEVTATAVKRIKYSPD… |
| A0A447XD46 | 28-150 | None |
| A0A485CQY0 | 44-185 | None |
| J2KVH3 | 3-150 | None |
| A0A1B8P576 | 12-222 | None |
| A0A7X3U039 | 45-208 | None |
| A0A3M5YZ86 | 37-187 | None |
| W1F7T9 | 1-140 | None |
| A0A6A5KY21 | 650-867 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.