DPCstruct | MC56495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 108 ± 10 aa |
| Standard deviation of domain lengths | 10.31 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6Y515 | 119-237 | FVNTEKTVPSIQAVNRQQEALISGLLRLHATHIYSEYWTCDRISFQSNERIICAVVTNHIEQGYNRYLPYWSIITKDPHAFYIFPLR… |
| A0A455T070 | 1-102 | MINFLQRQGATHIYADYWTCDRLAFLSTERILCSVLDAGLRPGLDRYPPYRSLVEATLSPPYYVFPIGSPQDLRLQQLIALGYDYHR… |
| A0A5J4KVA4 | 202-318 | None |
| A0A535QR12 | 67-176 | None |
| A0A2V7WX36 | 1-99 | None |
| A0A402BIR2 | 32-150 | None |
| A0A6A7LN82 | 308-397 | None |
| A0A536H190 | 444-544 | None |
| A0A401ZPK3 | 1-122 | None |
| D6TRV3 | 114-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.