DPCstruct | MC56490
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 181 ± 34 aa |
| Standard deviation of domain lengths | 34.38 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P3C1S4 | 53-228 | KGIEDAGGLPALARQYGVRLNSLSNHILKNGNLTKRGEALIYQVKHPPTTRVTASLLQEIQALGPQGIKDAGGLPALARQYGVRFNS… |
| A0A378Z821 | 102-265 | GAAGIEAAGGPVGLARRENIPPAVPRHFLHGDGRLPQRGEVQHNPRGNVGITDAVLRQWAGIEAAGGIEGLARRFHVSLAAIRHYLR… |
| I0QM19 | 258-445 | None |
| A0A7C8GNP7 | 197-433 | None |
| A0A5E4ZUT1 | 202-398 | None |
| A0A031ISI8 | 688-882 | None |
| A0A378YYA1 | 206-401 | None |
| A0A378Z129 | 211-423 | None |
| A0A378Z355 | 44-201 | None |
| A0A378Z587 | 155-358 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.