DPCstruct | MC5649
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 79 ± 4 aa |
| Standard deviation of domain lengths | 4.04 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 79.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 61.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14753 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K3EJL1 | 4-82 | NTIKVDSNQAEAIDEYMLYHRIVGDDDNGRTFTPAEYEAYKKRVIPMRLKNRIYMSWVNPNGVDCVLTGPETQCFCTHR |
| A0A4W4EYB7 | 1-80 | MERIHIGKTAAEAVNAYLEYKRIVGEDDGGRLFTQAQYEEYKQSVVPSRLLNRLYVSFGVPGRIDCKHIGPETPCFCSHR |
| A0A3P8VV15 | 8-81 | None |
| A0A6J0E672 | 1-80 | None |
| A0A4W6EFM9 | 1-67 | None |
| F8WCP3 | 1-80 | None |
| H2YX32 | 1-80 | None |
| A0A820JZS3 | 12-90 | None |
| A0A5N4DYC7 | 1-80 | None |
| A0A819DCX4 | 11-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.