DPCstruct | MC5648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 216 ± 44 aa |
| Standard deviation of domain lengths | 43.76 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05719 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4JDZ2 | 1-191 | MLAEQILMLLYHPDTGRLLVSANKADLALGGALLVELTERQRIDLTEPHRVTKNRTVVVVDPTPTGDDVLDEALRRISAQRSTRAQV… |
| A0A3P7JXB7 | 3-186 | RKSLLTRKVTVKNSEPTGDVILDEALRHMKETNPPETVTSWIEYLSGETWNPLKLRYQLRNVRERLAKNLVEKGVLTTDKQNFLLFE… |
| A0A6H5J010 | 618-871 | None |
| A0A099D9N6 | 13-220 | None |
| L1KK34 | 1-175 | None |
| A0A354PXB9 | 2-205 | None |
| A0A1I8FM03 | 2-200 | None |
| A0A2H1L4X5 | 1-198 | None |
| A0A7R8X7N7 | 599-829 | None |
| A0A2J6IDR9 | 6-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.