DPCstruct | MC56476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 167 ± 12 aa |
| Standard deviation of domain lengths | 12.44 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379MST1 | 1-162 | MINVRKEFERYEAVLTNTLGSETLMRNSMTMLKEFAAKTPYVLTELVGGFVKLVNQGVKPTEAEMVKLGDLASSQGKSFDQLVEVII… |
| A0A1T4YRG2 | 212-380 | KETKIDPFKDMLTKIFGSPQAAQQAWPEIAPLVNTFQMDQVANAYKALAAAGLQPNKAMLTALGDVTLAIRSNLQSVAEAVVAATKG… |
| A0A268HZC1 | 218-387 | None |
| A0A1I2Y726 | 139-304 | None |
| A0A7K3XDI9 | 66-239 | None |
| A0A2D8J239 | 54-230 | None |
| A0A352QNA1 | 37-191 | None |
| A0A2S2DRR0 | 1-187 | None |
| A0A7C9UYT6 | 78-245 | None |
| A0A327NFP8 | 25-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.