DPCstruct | MC56473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 133 ± 18 aa |
| Standard deviation of domain lengths | 18.18 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13734 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A413EFL1 | 2-134 | LFFMKYIFFFLILFSSKHILLANEITMEQARKVAMSFFCETIRSRGGIPRLQLVWDGESTTTRGGSSPAFYVFNRMDSDGFVIISGD… |
| G5K9I3 | 4-95 | VRTEAQAHQEAETFCQANPQHNDVRVQQLIYPLDNSHTSSEVYIYSLFPTGFIIVSGDTRAHTILGYSFNNDLDINQKSVWGMIEAY… |
| A0A7Y3P260 | 7-137 | None |
| A0A1W9SJW2 | 1-135 | None |
| A0A4R6LIP3 | 11-168 | None |
| A0A7X7BXH3 | 16-145 | None |
| A0A2N5YS76 | 6-141 | None |
| R6Z5K7 | 25-154 | None |
| A0A1F3L9J3 | 10-138 | None |
| A0A7C9N0M2 | 4-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.