DPCstruct | MC56472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 108 |
|---|---|
| Mean domain length (aa) | 356 ± 68 aa |
| Standard deviation of domain lengths | 68.41 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 13.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q52NW7 | 222-539 | ALSKKDWQAKLTTDELAEQEKERATINKRLGYFATEHEKVGIVHKALEPKLKPFQQIEKEWRQCKVKSKSTFPNSMTFVQNPAYQAV… |
| A0A1H4KFM0 | 15-430 | LASLQTATLLASTYFRRSGQARSALHGLSVGGGDEDRSEQLVRALRLRVAIQSAVKLTDAADEINRRPTFHYRRRRHSSRGEVRGML… |
| A0A7V3JS35 | 5-308 | None |
| A0A0R1SBM5 | 107-545 | None |
| D6BJ52 | 4-380 | None |
| A0A7V8YEP2 | 1-276 | None |
| A0A3E1ER55 | 147-607 | None |
| A0A495ABY5 | 280-649 | None |
| A0A2H6JT04 | 2-312 | None |
| A0A426TXE9 | 27-470 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.