DPCstruct | MC56470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 126 ± 26 aa |
| Standard deviation of domain lengths | 26.46 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.56 |
| Pfam Score | 79.17 |
| Assigned Pfam label(s) | CL0023- PF21096 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P2B214 | 380-480 | RIQSIKQGGENIGNRTRIRVTKNKVAAPFREAEFDIMFYENGISKNGEIVDLGTDLGIIEKRGAFYRYNEELLGQGRENAKQFLAEN… |
| J9R2B3 | 11-102 | IKNRDETIGSRVKVKIIKNKVAPPFKQAEFEIMYGEGISKTREILDQAVELGIVKKSSSWFSYEDTKLGQGRDTVKEVLRDNPELAD… |
| A0A7V9EYY4 | 310-425 | None |
| A0A838FU90 | 1051-1140 | None |
| D6PL39 | 1-119 | None |
| A0A1Z9FBA6 | 128-284 | None |
| A0A7C6VBQ9 | 5-105 | None |
| A0A6J0PQX3 | 235-365 | None |
| A0A2D5WG61 | 193-354 | None |
| A0A6D2L2X1 | 641-763 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.