DPCstruct | MC56467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 165 |
|---|---|
| Mean domain length (aa) | 207 ± 49 aa |
| Standard deviation of domain lengths | 49.47 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 86.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.97 |
| Pfam Score | 62.73 |
| Assigned Pfam label(s) | PF21218- CL0167- CL0303- PF09292- PF01149 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T5BI95 | 39-241 | GQKIKSIKSFGKQLLISFDDFAVRIHLMLFGYYAINDTFPAGKLRLGLHFKEGEINFYAADVRFLEEPITDLYDWRIDVLDSVFDKK… |
| A0A7Z1R191 | 22-226 | AGTLLVHLGMSGRLLLCDPSRPVLPHTHLTLGLGPALELRFVDPRRFGLIEWLQPGDEAFHSTLSALGVEPLDERAARELPPLLHAR… |
| A0A7V8NSU8 | 11-171 | None |
| H0ERC7 | 2-122 | None |
| A0A7W1TI35 | 44-271 | None |
| A0A7C3DXT8 | 1-245 | None |
| A0A835XS69 | 140-348 | None |
| A0A6N2DVV8 | 14-196 | None |
| A0A4Y7JPN0 | 234-394 | None |
| A0A538QD36 | 2-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.