DPCstruct | MC56466
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 159 ± 29 aa |
| Standard deviation of domain lengths | 29.33 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 23.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0142 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G8NAP8 | 8-156 | LSGLLLGLLFHRLGLPGGAVVGAMLGTGLHQLLLPPAPTPRGLDLLVQLLAGILVGLAFRKDLLAPRLLPYAALAALAFLSLALLLS… |
| A0A6F8SWU4 | 2-110 | NLMLWVLGSAIGSRFQGMTRRLLGRYLWQSGIATLLALVVLAVFAELIHQTVGVGRDVALLALAPGGIGEMAILAVALNIDPVFVAF… |
| A0A2D5P6F6 | 82-240 | None |
| F8FAP9 | 93-251 | None |
| A0A2N0QKC2 | 25-190 | None |
| A0A120JWA3 | 9-125 | None |
| A0A2W4N368 | 86-264 | None |
| A0A0N0Z2K8 | 3-185 | None |
| A0A2A6LQ76 | 2-95 | None |
| A0A7J9VS25 | 198-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.