DPCstruct | MC56458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 98 ± 18 aa |
| Standard deviation of domain lengths | 18.00 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 24.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07277 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5A0B6 | 2-110 | EFCNNFEQERVRSESFVALLKELDLFEVREATFTPRNADGSAGAPQKIAEYFAVSEDKLKALPAEKLAELRDNGALGQIYAHLVSLL… |
| A0A2N1C8J2 | 145-232 | KILADLTQGFVLNRAFITLLSEYDLIESVTLDIKYNNSQECKLEGLYSINQTMLEKVPTDIQKQFEQQGYVPLMSAMLSSINHVSTLI |
| A0A381ZBU8 | 102-189 | None |
| A0A351MF28 | 178-273 | None |
| A0A2S2CK81 | 3-86 | None |
| A0A2E4QSY2 | 165-271 | None |
| A0A7W6EGL3 | 137-234 | None |
| A0A081BDR7 | 55-143 | None |
| T0KC84 | 335-460 | None |
| A0A523Q0Y3 | 3-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.