DPCstruct | MC56456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 116 ± 6 aa |
| Standard deviation of domain lengths | 5.79 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 69.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04121 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4D300 | 392-506 | GELVRFQAGVTMEILRLDAWYSSKDGSPEGPATYIVRGLCRRCCIPEVILRCMQVSVSLVESGNPLESHDELIELVASPETGFLHLF… |
| A0A5D2JH95 | 232-346 | GELARFQAGVTLEISRLDAWFSSKDGSLDGPATYIVQGLCRRCCIPEVILRCMQVSVSLMESGNPFESHDQLIELVSSSETGFINLF… |
| A0A452XR19 | 168-283 | None |
| A0A2G9HUX7 | 71-188 | None |
| A0A452XR03 | 1-104 | None |
| A0A0R0FJK7 | 134-251 | None |
| B4FPH4 | 71-196 | None |
| A0A2P2K3Y0 | 120-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.