DPCstruct | MC56452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 107 |
|---|---|
| Mean domain length (aa) | 111 ± 21 aa |
| Standard deviation of domain lengths | 21.36 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.53 |
| Pfam Score | 97.55 |
| Assigned Pfam label(s) | CL0020- PF11523 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1D8Q6 | 5-95 | IEIGNKIFRYKKDALLHFKNILNSYDFGESLNSKDFNDVYELLKRHPRAKEKIGVGIKGFKIGKVQYHTKCFEFIRTDATTGYFGYV… |
| A0A384IR86 | 17-136 | GGGMARSTPVWIGNRHYPSKTKAQEACRDLVAKYPGNGEGVGPVSPQGHPQLVDDPDDIAFLHDLVKLHPTPDQVTGSGVKHFLVSV… |
| A0A1U8JVD9 | 67-189 | None |
| A0A0A9DFQ9 | 68-213 | None |
| A0A7N2KRP7 | 280-359 | None |
| A0A7J9D3T9 | 2-94 | None |
| A0A286E7X2 | 122-229 | None |
| A0A7S2AZK5 | 78-205 | None |
| A0A6V7P875 | 98-212 | None |
| A0A2G2WQY4 | 57-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.