DPCstruct | MC56451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 126 ± 14 aa |
| Standard deviation of domain lengths | 13.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06652 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4HUH3 | 11-142 | LLLNLQSLSAEIADCSFFDTVDISEGQRLSNGSYLYEGLLIPAHLTATYEFKLLANGDKEQVPSHVRGCVCKLRTCVRFCCPHDHIM… |
| A0A2P8XIP3 | 37-157 | KNTTKPCSEMMSVEITKFNTFSNGSVLALDDIPTMYPAHMIWNSTDRRNATKMWGCLCAIKHCIRKCCPEHTTIAAVDGRCISSSNP… |
| A0A5E4Q2E7 | 93-207 | None |
| A0A6I8VPZ9 | 42-175 | None |
| A0A6P4EJ51 | 12-140 | None |
| A0A1B0C5F6 | 12-138 | None |
| A0A232FK76 | 336-461 | None |
| A0A821WWU8 | 12-135 | None |
| A0A6J3BZX9 | 5-124 | None |
| A0A1I8NGG9 | 15-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.