DPCstruct | MC5645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 77 ± 5 aa |
| Standard deviation of domain lengths | 5.17 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 54.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N9YCR6 | 1-75 | MWRLARSFELLDPLRKRIEAGMPAYGSCAGMIMLADRIRDGAAGQETCGGIDMTVRRNAFGRQVDSFEARVPLTG |
| A0A6V8PW69 | 1-73 | IPGGESTTMGRLMQKYDLIEPIREMGQEGVPIYGTCAGLILLAVKTVEGGQPLLELMDMVARRNAFGRPVDSF |
| A0A7V9QZR5 | 164-238 | None |
| A0A067G4D3 | 43-118 | None |
| A0A3P1URX6 | 290-364 | None |
| A0A2J7ZZV6 | 637-730 | None |
| A0A822Y7F1 | 43-118 | None |
| A0A446BSD9 | 64-140 | None |
| A0A4V3XAP6 | 56-130 | None |
| A0A0E0G0L2 | 844-916 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.