DPCstruct | MC56447
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 179 ± 32 aa |
| Standard deviation of domain lengths | 31.65 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09737 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397JDB8 | 269-442 | WKMQFIDEKRFLIKFGNVDCVTGRHNDSAAHTSFFVIYDFLKTEVISVYDNASEEFLEEFKRSSEIFQRVAFNQPFLYNSTYSNNVY… |
| A0A453I7I8 | 3-169 | VQFLDRHHLFIKFGSVNGRVTRSTDQNLAFFAVYNMETTEIVSLYQNSSEELYSLFEHYYDHFHANPQNSLHEKFISSNPNSVHALD… |
| G1Q1Y9 | 168-329 | None |
| A0A016TXN4 | 81-248 | None |
| A0A446PQZ8 | 195-405 | None |
| A0A1B0BUS7 | 332-504 | None |
| A0A7R8X7Y3 | 364-578 | None |
| A0A177W7Z5 | 537-745 | None |
| A0A813SY05 | 44-214 | None |
| A0A5B8MJ93 | 374-590 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.