DPCstruct | MC56444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 704 ± 116 aa |
| Standard deviation of domain lengths | 116.23 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 35.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453I3R2 | 10-666 | RMEARLKEDILREAERYDGAIMVIHETDNGEIFDAWENVNNEAVLTPLEVYKCLDSEGLPIKYARVPITDGKAPKSSDFDTVAFNVA… |
| T0PHW4 | 100-812 | AQGTKVLGKYILKSDRMPDQITLVSAHKDIAPNFRRLPGLPIYGGAQPSLAGIHHILETIATDGYKHVIWVNLREEAVLFVGGESYT… |
| A0A835IQI8 | 23-815 | None |
| A0A4E0RQZ2 | 71-1019 | None |
| A0A6D2JIT6 | 32-771 | None |
| A0A5J5UPE7 | 4-860 | None |
| A0A498MQZ9 | 65-791 | None |
| A0A834M040 | 341-1150 | None |
| A0A3S3N9Q7 | 4-658 | None |
| A0A7I8VVK6 | 96-777 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.