DPCstruct | MC56441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 411 ± 63 aa |
| Standard deviation of domain lengths | 63.29 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.19 |
| Pfam Score | 96.69 |
| Assigned Pfam label(s) | CL0065- PF08934 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V3ZPU4 | 51-357 | QEQKEVFIDQFCSASNLNQGEIASQRYQLAVRLYYRVIESMLDSEHERLSETDFSRLLNIGSFHQSLLACSIEVVLVTYGNPSTGAM… |
| A0A453HZF4 | 12-436 | PWAEARKMEASKLYYRVLEAICRAESLNTNVNNLTPLLSNERFHRCLIACSAELVLATHKTVIMMFPAVLESTGLTAFDLSKIIENF… |
| A0A556UZF0 | 31-388 | None |
| A0A7S1XE74 | 358-815 | None |
| A0A3P6ZIX0 | 184-728 | None |
| A0A3L6VK94 | 2-355 | None |
| E1ZEA5 | 183-727 | None |
| A0A0F8B1P2 | 101-478 | None |
| A0A5C6N6V1 | 140-594 | None |
| R7U2C1 | 1-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.