DPCstruct | MC56440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 146 ± 14 aa |
| Standard deviation of domain lengths | 13.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 44.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453HP64 | 1-134 | RVEDAVLIALAQHHRPNVAELSDPDIKSSGDEKFTEAFDLSKEEEEDVLFKQAWLMYFWRRAKIHNVEEDIAEERLQMWVDRHGQQP… |
| A0A5P1FPI5 | 299-447 | GEGNIENMLLVEKGLRELASLKVEEAVLLAMGQDRRANVKAGQSTSGATLSAEGPNTLEQFELSEEELEDVHFKQAWLTYFWRRAKN… |
| A0A5B8MVL8 | 194-357 | None |
| A0A452XZG3 | 133-249 | None |
| A0A453HPX1 | 88-235 | None |
| A0A6A2YXH7 | 259-401 | None |
| A0A835RFY4 | 125-267 | None |
| A0A5D2DF08 | 3-146 | None |
| A0A6P6FXD9 | 555-715 | None |
| A0A446JMT7 | 1-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.