DPCstruct | MC56431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 146 ± 20 aa |
| Standard deviation of domain lengths | 20.09 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 43.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453HD11 | 20-159 | QVPHTTFFLTHACFLFYHMASNMTLRRLRHSTAHLPQSIRWLFEAAWILALSYFIAYLETLAIANFPYYEFVDRDIMYTVGSLFYAI… |
| A0A287STX6 | 40-167 | LTHACFLFYHMTSNMTLRKLRHSIVNLPVSLQWLFEATWILALAYFIAYLETLAISNFPYYEFVDRDIMYTVGSLFYALYFLVSFPM… |
| D8R170 | 83-247 | None |
| A0A0G4F061 | 137-326 | None |
| A0A7S0RK26 | 2-109 | None |
| A0A7S3FMH2 | 26-161 | None |
| A0A7S1GNB7 | 2-130 | None |
| A0A3B6JGE2 | 99-217 | None |
| A0A812V6R7 | 356-486 | None |
| A0A453HDK5 | 49-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.