DPCstruct | MC5643
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 173 ± 21 aa |
| Standard deviation of domain lengths | 21.01 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U6MK11 | 967-1166 | LRNHPFFRLPRLQPGVKVQQFCVTSAFAFPNMIRHPSQTLGYMRTALAGDTLGESEANGVVLAAQRAVSHLLHFHQEEVPEKRVANA… |
| U6GS66 | 3-164 | RISRILKKPVVDSGDLRRLMQDLETLVDYAEHCAIENLDGLPPRYVAEKLGFAFLMMDGIYAATEVLGAKARRSEWWQQVIDRLPVY… |
| U6JUW3 | 248-436 | None |
| U6JWF8 | 119-287 | None |
| U6JWK5 | 141-303 | None |
| U6K1Z7 | 441-627 | None |
| U6K6R1 | 93-244 | None |
| U6K4X1 | 42-245 | None |
| U6JTW8 | 182-344 | None |
| U6KFB8 | 2-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.