DPCstruct | MC56421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 114 |
|---|---|
| Mean domain length (aa) | 273 ± 58 aa |
| Standard deviation of domain lengths | 58.32 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 90.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.65 |
| Pfam Score | 84.61 |
| Assigned Pfam label(s) | CL0344- PF04422- PF04432 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3AWA6 | 557-858 | VEEAQFGIYRSLYAGHALDTDIRKAGVAGGVVTALLAYGLESGALDCAIVAGWDETEPWKVAPKIATTRQELIDCSRSKYSISQTLS… |
| A0A452Z099 | 8-218 | EPVVHGRGRKDTMDEMYYGVHEQLLYARKMEPVQGAQWTGIVTTIAVEMLKSNMVDAVVCVQSDPDDRFAPRPVLARTPEEVIAARG… |
| A0A832B2T9 | 8-194 | None |
| W0ERN0 | 63-315 | None |
| A0A5C8EIC2 | 2-263 | None |
| N0BKY2 | 227-506 | None |
| A0A257MSE1 | 170-473 | None |
| A0A448Y3F7 | 598-993 | None |
| A0A3R6QY04 | 56-371 | None |
| A0A7X3MES7 | 44-376 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.