DPCstruct | MC5642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 97 ± 6 aa |
| Standard deviation of domain lengths | 5.63 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 49.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0228 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2DP42 | 43-137 | DNADGTADNTVVLQNLMEALEAGDAVCLFPEGISRFHPEVAPLKTGVARMVSDVLGRNRDDPDFEVSLLPCSVTYMHRQHFRSDVLV… |
| A0A1X2HGH9 | 100-194 | EGASYKCLPHVEQDAVYEAVYDELNRGQCITIFPEGGSHDRAEMLPFKAGVTIMALGAMAKHPGLDVKIVPCGLNYFHAHRFRSRAV… |
| A0A1E2Y3Q9 | 183-274 | None |
| C1GUI2 | 166-257 | None |
| A0A7S2SXG4 | 227-329 | None |
| A0A0V0QQ83 | 80-180 | None |
| A0A1X2GM57 | 112-205 | None |
| A0A433QNV0 | 148-241 | None |
| A0A0G4LE63 | 206-314 | None |
| A0A4P9ZBG2 | 98-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.