DPCstruct | MC56419
Metacluster Properties and Pfam Annotations
| Number of structural domains | 93 |
|---|---|
| Mean domain length (aa) | 92 ± 13 aa |
| Standard deviation of domain lengths | 12.94 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M3S3Q9 | 5-98 | TREMTIHMHAYLHKESFKKRAPKAIKIIRFLAIKTMKTHVVKFDMGLNQFIWSQGIRSVADRIRVRMARLPIEGEEGKFYTLVSYVP… |
| A0A2I0A7U1 | 171-268 | LFLFGVSWDPHILRQHTFKKKAPKAIKEIRKFAQKSMGTADVRIDVKVNKQIWSRGIRSVPRRVRVRIASKRNEEEDAKEEFYSLVT… |
| A0A2D9G8G6 | 2-73 | None |
| A0A842ML62 | 2-84 | None |
| A0A6A6KX70 | 17-99 | None |
| A0A7N2LB18 | 11-103 | None |
| A0A5P1F022 | 4-79 | None |
| A0A2H9P6D0 | 47-136 | None |
| A0A813A0Y9 | 147-245 | None |
| L9JBH4 | 9-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.