DPCstruct | MC56409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 128 ± 16 aa |
| Standard deviation of domain lengths | 15.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 59.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11909 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I7JD47 | 93-232 | KWSSDVEEFGSIGIYSPPEGGYEGRYATRLRREGYHILNLTARGLGDPEAYLTKIHGVRPPHLGKQAIARWYMPPEVDYRLSLLPKD… |
| A0A0H5PTZ8 | 1-126 | MEGGAETRLLRRLRGAGYRTRLWSARGLGDPEVFLTQKHGIRPPHLGHQSVGRGAAVGEVQEVVPQLGDLLDGDAQVALWLLEGQVL… |
| A9SZB8 | 2-130 | None |
| A0A2Z6MQX5 | 80-198 | None |
| Q5N7I5 | 309-433 | None |
| A0A077RXA1 | 62-186 | None |
| A0A4D9B1I5 | 70-194 | None |
| A0A846E2B9 | 1-106 | None |
| B1XK97 | 12-144 | None |
| A0A453G845 | 15-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.