DPCstruct | MC56407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 113 ± 12 aa |
| Standard deviation of domain lengths | 11.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4Q507 | 1-109 | MPGETPKIQSYYVPSLGPAPKWASFLDNLTEELEEDKQLVYEDYKFITREEVEQLNMVNMIGTGYLKAYMHGYFIHIKLYNKIKAIQ… |
| A0A5D2RW72 | 27-134 | LGLMLLALDASQIPAYFIPALGHVPKWCSSLESLTEELEEGGQTSIYDNYKFLTKEDLEKLNLTNLIGTNLLQAYMHGFFIDFRLYK… |
| A0A816WN61 | 804-911 | None |
| A0A0P1AUQ7 | 332-447 | None |
| A0A4U0VJ62 | 168-294 | None |
| A0A1Q9CET1 | 326-441 | None |
| A0A7R8X6G8 | 765-877 | None |
| K2H3P1 | 219-309 | None |
| A0A7D9M614 | 85-203 | None |
| A0A4Y9YEU6 | 911-1021 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.