DPCstruct | MC56403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 282 ± 51 aa |
| Standard deviation of domain lengths | 51.33 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9F725 | 1-189 | MDDKELRRLADRVAGQLLQNYEDYCDEFVAENGGDNAGLFEDAIQSEFYGRIAGMARAFNITPMHWRKYRKGKLDARSAIASLSRLV… |
| A0A0W8JCU3 | 6-282 | TMIQTEIDLSSIAWDDRAFVQQRLFCFPVEIQKLLLKAYLSKSTKFERNTYLRTTTEQIAAKLSVRQLELNLSEDDLREKAKYLAQS… |
| A0A7U3Z9I6 | 75-393 | None |
| A0A4U9D482 | 25-220 | None |
| A0A838ZWG5 | 3-219 | None |
| A0A8B5SGP2 | 17-332 | None |
| G7EFG5 | 4-210 | None |
| A0A7R7UY78 | 29-340 | None |
| A0A6S5WX30 | 47-293 | None |
| A0A2N0DV75 | 7-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.