DPCstruct | MC5640
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 159 ± 25 aa |
| Standard deviation of domain lengths | 24.88 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U6GLA3 | 452-618 | MQSGGSRTPNISFALFFSGLRKGDSAYTDRYASQETFEPRSPEEVEALCRAWEHYVHPRAREFWQTAEARIEILQKIARGVHRGYDP… |
| A0A7S3XIC3 | 2-140 | PAPPHVPRPENEVARFVDSWNSYIHPRAVEFLPENGRKGILNLIARSTSKGTDPILGDGTDNCVHWYGETKPEDGFDQPVVGFRKPG… |
| A0A1Q9C3H5 | 120-225 | None |
| A0A1Q9EN37 | 676-815 | None |
| A0A812Y1V6 | 17-149 | None |
| A0A1Q9CCD3 | 34-183 | None |
| A0A0G4FZK9 | 7-156 | None |
| A0A7J6LVD1 | 795-946 | None |
| A0A7S7LH62 | 6-183 | None |
| A0A2C6K0V0 | 129-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.