DPCstruct | MC564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 8.29 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 55.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672UBB8 | 26-102 | DEAGGDVAAAFLRLEQELNRLLRELPPPGEPVTHIYRPLDYAWEPHSDFVRRYCRAPKRVLFLGMNPGPFGMAQTGV |
| A0A6P4FR46 | 13-107 | LEDEEPKKSFPNKETTISDFFIEPLWSKFYKTEVKLNEILDKLTPPPNISHIYNPIVYASQLHCDYLRRYMQGPKPLVFIGMNPGPN… |
| A0A0K8R4Y9 | 1-77 | None |
| A0A673HAC0 | 2-104 | None |
| A0A2D4KMY4 | 6-86 | None |
| H2NHJ4 | 3-96 | None |
| A0A669QQ87 | 1-98 | None |
| A0A7J7ZMN7 | 11-100 | None |
| A0A5F9C5U9 | 18-103 | None |
| A0A6P4ZM00 | 142-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.