DPCstruct | MC56396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 6.18 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P3RYJ2 | 1-100 | MQMFSLAHRPVRLAEFRRAVTVATGQELSDNILDAVFKIFDLDGDECLSHGEFLGVMKNRMHRGLWVPQQLSIQEYWKCVKKESIKG… |
| A0A074ZFD5 | 350-438 | TFHHMAGVPIDQATLHHVALTVANIELSPHVVDVVFTLFDENNDGQLSYREFVGVMRRRLLRGLDKPMDTGFVRFVSALFKCTKEQI… |
| A0A1X7SEM9 | 18-106 | None |
| A0A654HAY1 | 59-147 | None |
| A0A6V7Y5J0 | 1152-1237 | None |
| A0A3Q3MTI0 | 219-304 | None |
| A0A7N8XBF0 | 158-233 | None |
| A0A7J5XN37 | 560-636 | None |
| A0A2G9T6P6 | 1-91 | None |
| A0A1Y3BA09 | 96-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.