DPCstruct | MC56391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 124 ± 21 aa |
| Standard deviation of domain lengths | 21.44 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08153 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P3RDS1 | 4-131 | PKYKGRSTINPSKASTNPDRVQGAGGQNMRDRATIRRLNMYRQKERRNSRGKVIKPLQYQSTVASGTVARVEPNIKWFGNTRVIKQS… |
| A0A391NVR3 | 12-95 | MRSKSTSKRIRMQRERSVRDKYGRKKFERYHNKTADLDGRIAPSMKWFGNTRVIGQTELADAREAAEKATHDPKSILIKAREIP |
| A0A6A4NEV9 | 1-125 | None |
| A0A0R3XCF2 | 1-104 | None |
| X6MI81 | 45-169 | None |
| A0A2Z6NQK1 | 15-127 | None |
| A0A0F2M9W6 | 19-128 | None |
| A0A409VWV0 | 6-131 | None |
| A0A6J2KFA2 | 1-155 | None |
| A0A1J6I7E6 | 1-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.