DPCstruct | MC56390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 109 ± 9 aa |
| Standard deviation of domain lengths | 8.94 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19936 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W7B9B5 | 1-93 | MSAKFQRISSAVEGHNGYLSGLHHAGRGFTQQTLRVLTIIHNFGIRRDDGTTAAQRLFAQSFPDLFEWVVPRMGELPRPRRTLKSPK… |
| A0A6I7X714 | 1-113 | MSDCKLQQWLSWAEWVVQHFHRSSSAVEGRNGFLSKMYHNGRGISESRLKALTVIHNYGLKRQDGTTAAQRFFEQDFPDLFSWILGQ… |
| A0A5K7ZE24 | 263-366 | None |
| A0A849ERT6 | 139-263 | None |
| A7C2A3 | 25-137 | None |
| A0A1Q8BPL4 | 206-309 | None |
| K9EKX1 | 63-175 | None |
| K9EU17 | 172-284 | None |
| A0A5C2HUS4 | 89-207 | None |
| A0A7X1L123 | 19-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.