DPCstruct | MC5639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 92 ± 10 aa |
| Standard deviation of domain lengths | 10.23 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 50.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7QVE1 | 22-126 | KPLVRFSGVVHAVTTTEDPVIQKLARESNGNVFCTDRMAQAIMCAHKSVDSWDLIAIRIADKLFFDVRPDSNFELVTVAETAADPPN… |
| U6GBE9 | 10-110 | SNFYYYWVTTQDDEVIKEYMLNGEHRVDVAATDQVLSCLMSAPQSKYSWHLYLTKIEGKIIIDKANGSVVDLLTVNETSAEPPMQDA… |
| A0A815JL73 | 167-270 | None |
| K7HKA7 | 1-99 | None |
| G5BU26 | 230-314 | None |
| A0A368FZY0 | 487-576 | None |
| A0A815PGL0 | 94-198 | None |
| A0A0N1PDH4 | 202-321 | None |
| A0A819S121 | 353-457 | None |
| A0A2G3CG90 | 2-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.