DPCstruct | MC56383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 181 ± 20 aa |
| Standard deviation of domain lengths | 19.62 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A829XC03 | 93-267 | VLTKDVQVEARRLTSVIPNLATLNSLFAQIKNQACGTSTASSPCITFRYPVDGCYARAHKMRQILINAGYDCEKQFVYGNLRASTGT… |
| A0A4Q6ES64 | 90-290 | LELVAPRRQSLNEVDKLNELTLKELEDLPVARARGSRRTTADHLARSQIFKALEENPVASLCELHRWDPTSTVGLCFGRAVAAHIQA… |
| A0A849WXP8 | 104-334 | None |
| A0A844S3E9 | 159-329 | None |
| A0A212KTV7 | 11-133 | None |
| A0A849WX70 | 134-331 | None |
| A0A838F446 | 48-232 | None |
| A0A849WPV4 | 454-630 | None |
| A0A1F3SXU9 | 28-199 | None |
| A0A1F3XXU5 | 143-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.